PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi11g09550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family YABBY
Protein Properties Length: 203aa    MW: 22654.4 Da    PI: 4.4782
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi11g09550.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY97.23.8e-306102294
            YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkeelleelkveeenlksnvekees 91 
                      ++f+ +eq+CyvqC+fC+til+vsvP +sl++vvtvrCGhCtsllsvn++kas    +lla+ shl+ +   + ++ +++ +++  s ++ +++
  Vradi11g09550.1   6 HLFDLPEQICYVQCGFCTTILMVSVPCSSLSMVVTVRCGHCTSLLSVNMMKASfvpfHLLASLSHLEPKESSPEQDANRTLNSHSASLMTYSDC 99 
                      7899***********************************************9999999*********998888888888888888887777776 PP

            YABBY  92 ast 94 
                      +++
  Vradi11g09550.1 100 EEE 102
                      654 PP

2YABBY53.78.5e-17116147135166
            YABBY 135 eeiqrikasnPdishreafsaaaknWahfPki 166
                      eei+r+ka+nPd++h+eafs+aaknWa fP+ 
  Vradi11g09550.1 116 EEIKRLKAENPDMAHKEAFSTAAKNWANFPPT 147
                      9*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.6E-4011148IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MSTLNHLFDL PEQICYVQCG FCTTILMVSV PCSSLSMVVT VRCGHCTSLL SVNMMKASFV  60
PFHLLASLSH LEPKESSPEQ DANRTLNSHS ASLMTYSDCE EEDLIPMSNI VNKRTEEIKR  120
LKAENPDMAH KEAFSTAAKN WANFPPTQCK GDDQESCSQT DQLVDLDSQV DPPDAEVNEE  180
DDQGFRGRKV QRNSIFERTP FE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150434e-69AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520420.11e-145PREDICTED: axial regulator YABBY 4-like isoform X3
SwissprotQ9LDT31e-60YAB4_ARATH; Axial regulator YABBY 4
TrEMBLA0A0L9US491e-143A0A0L9US49_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T3C31e-143A0A0S3T3C3_PHAAN; Uncharacterized protein
STRINGGLYMA01G03580.21e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61442852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23420.16e-62YABBY family protein